missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human CXCR2 (aa 3-48) Control Fragment Recombinant Protein Código de producto.: 30209580

Invitrogen™ Human CXCR2 (aa 3-48) Control Fragment Recombinant Protein

Código de producto. 30209580
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30209580

Marca: Invitrogen™ RP102608

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83213 (PA5-83213. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CXCR2 is a receptor for interleukin-8, which is a powerful neutrophil chemotactic factor. It is a member of the GPCR family. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to GRO/MGSA and NAP-2 also with a high affinity. It has been reported to be expressed in a wide variety of tissues. ESTs have been isolated from human placenta and thymus libraries.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P25025
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3579
Nombre Human CXCR2 (aa 3-48) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C Cmotif chemokine; C x C motif chemokine; CC motif chemokine; CCmotif chemokine; CD128; CD182; CD182 antigen; CDw128; CDw128b; chemokine (C-X-C motif) receptor 2; chemokine (CXC) receptor 2; chemokine (C-X-C) receptor 2; Cmkar2; CXC; C-X-C chemokine receptor type 2; CXC motif chemokine; C-X-C motif chemokine receptor 2; Cxcr2; CXC-R2; CXCR-2; CXCR2 gene for IL8 receptor type B; Gpcr16; GRO/MGSA receptor; high affinity interleukin-8 receptor B; IL-8 receptor alpha chain; Il-8 receptor b; IL-8 receptor beta; IL-8 receptor type 2; IL-8 R B; IL8R2; IL8RA; Il8rb; IL-8 rb; IL-8 Rh; interleukin 8 receptor B; interleukin 8 receptor type 2; interleukin 8 receptor, beta; interleukin-8 receptor type B; mIL-8 RH
Nombre común CXCR2
Símbolo de gen CXCR2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human CXCR2 (aa 3-48) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado