missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CXCR2 (aa 3-48) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102608
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83213 (PA5-83213. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CXCR2 is a receptor for interleukin-8, which is a powerful neutrophil chemotactic factor. It is a member of the GPCR family. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to GRO/MGSA and NAP-2 also with a high affinity. It has been reported to be expressed in a wide variety of tissues. ESTs have been isolated from human placenta and thymus libraries.
Especificaciones
| P25025 | |
| Blocking Assay, Control | |
| 3579 | |
| 100 μL | |
| C Cmotif chemokine; C x C motif chemokine; CC motif chemokine; CCmotif chemokine; CD128; CD182; CD182 antigen; CDw128; CDw128b; chemokine (C-X-C motif) receptor 2; chemokine (CXC) receptor 2; chemokine (C-X-C) receptor 2; Cmkar2; CXC; C-X-C chemokine receptor type 2; CXC motif chemokine; C-X-C motif chemokine receptor 2; Cxcr2; CXC-R2; CXCR-2; CXCR2 gene for IL8 receptor type B; Gpcr16; GRO/MGSA receptor; high affinity interleukin-8 receptor B; IL-8 receptor alpha chain; Il-8 receptor b; IL-8 receptor beta; IL-8 receptor type 2; IL-8 R B; IL8R2; IL8RA; Il8rb; IL-8 rb; IL-8 Rh; interleukin 8 receptor B; interleukin 8 receptor type 2; interleukin 8 receptor, beta; interleukin-8 receptor type B; mIL-8 RH | |
| CXCR2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CXCR2 (aa 3-48) Control Fragment | |
| RUO | |
| CXCR2 | |
| Unconjugated | |
| Recombinant | |
| DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human CXCR2 (aa 3-48) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido