Learn More
Invitrogen™ Human CSF1R (aa 232-347) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP102148
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CSF1R (FMS) is involved in the production, differentiation, and function of macrophages, and is implicated in promyelocytic leukemias. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. CSF1R is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in the gene encoding CSF1R have been associated with a predisposition to myeloid malignancy.Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and plays an important role in innate immunity and in inflammatory processes. The first intron of the CSF1R gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Mutations in the CSF1R gene have been associated with a predisposition to myeloid malignancy.
Especificaciones
P07333 | |
Blocking Assay, Control | |
1436 | |
100 μL | |
AI323359; CD115; CD115 antigen; C-FMS; colony stimulating factor 1 receptor; colony stimulating factor 1 receptor, formerly McDonough feline sarcoma viral (v-fms) oncogene homolog; CSF-1 receptor; CSF1R; CSF-1 R; CSF-1-R; CSFIR; Csfmr; CSFR; EC 2.7.10.1; FIM2; Fim-2; FMS; fms proto-oncogene; HDLS; kinase CSFR; macrophage colony stimulating factor I receptor; macrophage colony-stimulating factor 1 receptor; McDonough feline sarcoma viral (v-fms) oncogene homolog; M-CSFR; M-CSF-R; mrfms; OTTHUMP00000224093; protein-tyrosine kinase; proto-oncogene c-Fms; proto-oncogene fms | |
Csf1r | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CSF1R (aa 232-347) Control Fragment | |
RUO | |
CSF1R (CD115) | |
Unconjugated | |
Recombinant | |
NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.