missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CSF1R (aa 232-347) Control Fragment Recombinant Protein

Código de producto. 30208989
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208989

Marca: Invitrogen™ RP102148

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CSF1R (FMS) is involved in the production, differentiation, and function of macrophages, and is implicated in promyelocytic leukemias. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. CSF1R is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in the gene encoding CSF1R have been associated with a predisposition to myeloid malignancy.Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and plays an important role in innate immunity and in inflammatory processes. The first intron of the CSF1R gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Mutations in the CSF1R gene have been associated with a predisposition to myeloid malignancy.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P07333
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1436
Nombre Human CSF1R (aa 232-347) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI323359; CD115; CD115 antigen; C-FMS; colony stimulating factor 1 receptor; colony stimulating factor 1 receptor, formerly McDonough feline sarcoma viral (v-fms) oncogene homolog; CSF-1 receptor; CSF1R; CSF-1 R; CSF-1-R; CSFIR; Csfmr; CSFR; EC 2.7.10.1; FIM2; Fim-2; FMS; fms proto-oncogene; HDLS; kinase CSFR; macrophage colony stimulating factor I receptor; macrophage colony-stimulating factor 1 receptor; McDonough feline sarcoma viral (v-fms) oncogene homolog; M-CSFR; M-CSF-R; mrfms; OTTHUMP00000224093; protein-tyrosine kinase; proto-oncogene c-Fms; proto-oncogene fms
Nombre común CSF1R (CD115)
Símbolo de gen Csf1r
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado