missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CSF1 (P09603) Recombinant Protein
Click to view available options
Cantidad:
10 μg
Tamaño de la unidad:
10 microgramos
Descripción
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]
Sequence: MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Especificaciones
Especificaciones
| Número de acceso | P09603 |
| Para utilizar con (aplicación) | Functional Study, SDS-PAGE |
| Formulación | Lyophilized |
| ID de gen (Entrez) | 1435 |
| Peso molecular | 36.8kDa |
| Nombre | CSF1 (Human) Recombinant Protein |
| Método de preparación | Escherichia coli expression system |
| Pruebas de control de calidad | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Cantidad | 10 μg |
| Inmunógeno | MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS |
| Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido