missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 16151560

Abnova™ Human CSF1 (P09603) Recombinant Protein

Código de producto. 16151560
Change view
Click to view available options
Cantidad:
10 μg
Tamaño de la unidad:
10 microgramos
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
16151560 10 μg 10 microgramos
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 16151560 Proveedor Abnova™ N.º de proveedor P4421.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Used for Func, SDS-PAGE

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Especificaciones

Número de acceso P09603
Para utilizar con (aplicación) Functional Study, SDS-PAGE
Formulación Lyophilized
ID de gen (Entrez) 1435
Peso molecular 36.8kDa
Nombre CSF1 (Human) Recombinant Protein
Método de preparación Escherichia coli expression system
Pruebas de control de calidad 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Cantidad 10 μg
Inmunógeno MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Requisitos de almacenamiento Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Concentración de endotoxinas <0.1 EU/μg
Alias de gen MCSF/MGC31930
Nombre común CSF1
Símbolo de gen CSF1
Actividad biológica The activity is determined by the dose-dependent proliferation of mouse NFS-60 cells. The expected ED50 for this effect is 1.4-2.1ng/mL.
Especie E. coli
Recombinante Recombinant
Etiqueta de proteína None
Sistema de expresión Escherichia coli expression system
Formulario Lyophilized
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.