missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Connexin 43 (aa 242-306) Control Fragment Recombinant Protein

Código de producto. 30207106
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30207106

Marca: Invitrogen™ RP108378

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Connexin 43 (Cx43) is a member of the gap junction protein family. Connexins assemble as a hexamer and are transported to the plasma membrane to create a hemichannel that can associate with hemichannels on nearby cells to create cell-to-cell channels. Clusters of these channels assemble to make gap junctions. Gap junction communication is important in development and regulation of cell growth. Phosphorylation of Cx43 is important in regulating assembly and function of gap junctions. Ser368 of Cx43 is phosphorylated by protein kinase C (PKC) after activation by phorbol esters, which decreases cell-to-cell communication. Src can interact with and phosphorylate Cx43 to alter gap junction communication. GFAP are membrane-spanning proteins that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is also targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5. Mutations in the GFAP gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy, oculodentodigital dysplasia and heart malformations. Alternatively spliced transcript variants of GFAP have been found.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P17302
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2697
Nombre Human Connexin 43 (aa 242-306) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen alpha 1 connexin; AU042049; AVSD3; AW546267; CMDR; Cn x 43; connexin 43; connexin43; connexin-43; c x 43; Cx-43; c x 43 protein; c x 43a1; C x 43 alpha1; CXA1; Cxn-43; DFNB38; EKVP; etID309742.9; gap junction 43 kDa heart protein; Gap junction alpha-1 protein; gap junction membrane channel protein; gap junction membrane channel protein alpha 1; gap junction protein; gap junction protein alpha 1; gap junction protein connexin 43; gap junction protein, alpha 1; gap junction protein, alpha 1, 43 kD (connexin 43); gap junction protein, alpha 1, 43 kDa; gap junction protein, alpha 1, 43 kDa (connexin 43); gja1; Gja-1; GJAL; HLHS1; HSS; Npm1; ODD; ODDD; ODOD; PPKCA; SDTY3; shf; Short fin protein; sof; stopsel; stp; Syndactyly type III; vascular smooth muscle connexin43; Vascular smooth muscle connexin-43; zfC x 43.3
Nombre común Connexin 43
Símbolo de gen GJA1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado