missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30205190

Invitrogen™ Human CLIP1 (aa 1288-1437) Control Fragment Recombinant Protein

Código de producto. 30205190
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30205190 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30205190 Proveedor Invitrogen™ N.º de proveedor RP92538

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82930 (PA5-82930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLIP170 was initially identified as a new type of intermediate filament associated protein that is highly expressed in Reed-Sternberg cells, the tumoral cells diagnostic for Hodgkin's disease. Later experiments showed that it is located at microtubule plus ends and is required for the binding of endocytic carrier vesicles. CLIP170 has also been suggested to act with LIS1, a protein implicated in brain development, to regulate dynein/dynactin binding microtubules. Other studies suggest that CLIP170 can influence the formation of lamellipodia and cell invasion by invasive breast cancer cells by regulating the release of kinesin and IQGAP1 from a complex of those proteins, CLIP170 and Rac1. At least two isoforms of CLIP170 are known to exist.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P30622
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 6249
Nombre Human CLIP1 (aa 1288-1437) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1110007I12Rik; 4631429H07Rik; AV017631; C81039; CAP-Gly domain containing linker protein 1; CAP-Gly domain-containing linker protein 1; CLIP; Clip 170; Clip1; CLIP170; CLIP-170; Clip50; Cyln1; cytoplasmic linker protein 1; Cytoplasmic linker protein 170; Cytoplasmic linker protein 170 alpha-2; cytoplasmic linker protein 50; cytoplasmic linker protein CLIP-170; Kiaa4046; MGC131604; mKIAA4046; Reed-Steinberg cell-espressed intermediate filament-associated protein; Reed-Sternberg intermediate filament-associated protein; Restin; restin (Reed-Steinberg cell-espressed intermediate filament-associated protein); restin (Reed-Steinberg cell-expressed intermediate filament-associated protein); Rsn
Nombre común CLIP1
Símbolo de gen CLIP1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.