missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Claudin 18 (aa 191-261) Control Fragment Recombinant Protein

Código de producto. 30195900
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30195900 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30195900

Marca: Invitrogen™ RP91184

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Claudin-18 is a tight junction protein expressed as lung-and stomach-specific isoforms which are generated by alternative splicing of the claudin-18 gene. The lung-specific form is a downstream target gene regulated by the T/EBP/NKX2.1 transcription factor. A splice variant lacking the C-terminal cytoplasmic domain also exists in mouse, but has not been confirmed in human. Human claudin-18 demonstrates 88% amino acid sequence identity to the mouse protein. Immunohistochemical studies have demonstrated complete membrane localization of claudin-18 in lung and stomach epithelial cells, while electron microscopy has shown that it is concentrated in the cell-cell borders of these cells. These features suggest a potentially important role for claudin-18 in the structure and function of tight junctions in the lung and stomach. Claudin-18 expression has also been reported in the inner ear.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P56856
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 51208
Nombre Human Claudin 18 (aa 191-261) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen claudin 18; claudin 18-like; claudin-18; CLDN18; SFTA5; SFTPJ; surfactant associated 5; surfactant associated protein J; surfactant, pulmonary associated protein J; UNQ778/PRO1572
Nombre común Claudin 18
Símbolo de gen Cldn18
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.