missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CHKA (aa 341-431) Control Fragment Recombinant Protein

Código de producto. 30200733
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200733

Marca: Invitrogen™ RP91725

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54995 (PA5-54995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. Choline kinase alpha is the initial enzyme in the sequence and may play a regulatory role. This protein also catalyzes the phosphorylation of ethanolamine.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P35790
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1119
Nombre Human CHKA (aa 341-431) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CHETK-alpha; CHK; CHKA; ChoK; Choline kinase alpha; choline kinase R; choline/ethanolamine kinase alpha; CK; CK/EK-alpha; CKI; Ckr; CK-R; EK; ethanolamine kinase; EtnK-alpha
Nombre común CHKA
Símbolo de gen CHKA
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKIS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado