Learn More
Invitrogen™ Human CHD3 (aa 1558-1658) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108089
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67428 (PA5-67428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.
Especificaciones
Q12873 | |
Blocking Assay, Control | |
1107 | |
100 μL | |
2600010P09Rik; AF020312; ATP-dependent helicase CHD3; CG9594; CG9594-PA; CHD3; CHD-3; Chd3-PA; Chd7; chromodomain helicase DNA binding protein 3; chromodomain-helicase-DNA-binding protein 3; dCHD3; DmCHD3; Dmel\CG9594; Dmel_CG9594; hZFH; MGC40857; Mi 2 A; Mi2 ALPHA; Mi-2 alpha; mi-2 autoantigen 240 kDa protein; Mi-2 A; Mi2-alpha; Prp7; Prp9 1; Prp9-1; ZFH; Zinc finger helicase; zinc-finger helicase (Snf2-like) | |
CHD3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CHD3 (aa 1558-1658) Control Fragment | |
RUO | |
CHD3 | |
Unconjugated | |
Recombinant | |
PAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.