Learn More
Invitrogen™ Human CGBP (aa 325-464) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89370
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111200 (PA5-111200. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001).
Especificaciones
Q9P0U4 | |
Blocking Assay, Control | |
30827 | |
100 μL | |
2410002I16Rik; 5830420C16Rik; AI426635; CFP 1; CFP1; CGBP; CpG binding protein; cpG-binding protein; cpG-binding protein; CXXC-type zinc finger protein 1; CXXC 1; CXXC finger 1; CXXC finger 1 (PHD domain); CXXC finger protein 1; Cxxc1; CXXC-type zinc finger protein 1; DNA-binding protein with PHD finger and CXXC domain; hCGBP; HsT2645; PCCX 1; Pccx1; PHD finger and CXXC domain-containing protein 1; PHF 18; PHF18; SPP 1; SPP1; ZCGPC 1; ZCGPC1; zinc finger, CpG binding-type containing 1 | |
CXXC1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CGBP (aa 325-464) Control Fragment | |
RUO | |
CGBP | |
Unconjugated | |
Recombinant | |
VKVKHVKRREKKSEKKKEERYKRHRQKQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.