missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30201396

Invitrogen™ Human CGBP (aa 325-464) Control Fragment Recombinant Protein

Código de producto. 30201396
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30201396 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201396

Marca: Invitrogen™ RP89370

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111200 (PA5-111200. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9P0U4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 30827
Nombre Human CGBP (aa 325-464) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2410002I16Rik; 5830420C16Rik; AI426635; CFP 1; CFP1; CGBP; CpG binding protein; cpG-binding protein; cpG-binding protein; CXXC-type zinc finger protein 1; CXXC 1; CXXC finger 1; CXXC finger 1 (PHD domain); CXXC finger protein 1; Cxxc1; CXXC-type zinc finger protein 1; DNA-binding protein with PHD finger and CXXC domain; hCGBP; HsT2645; PCCX 1; Pccx1; PHD finger and CXXC domain-containing protein 1; PHF 18; PHF18; SPP 1; SPP1; ZCGPC 1; ZCGPC1; zinc finger, CpG binding-type containing 1
Nombre común CGBP
Símbolo de gen CXXC1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia VKVKHVKRREKKSEKKKEERYKRHRQKQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.