missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CELSR2 (aa 2097-2242) Control Fragment Recombinant Protein

Código de producto. 30197028
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197028

Marca: Invitrogen™ RP90867

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. The specific function of this particular member has not been determined.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9HCU4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1952
Nombre Human CELSR2 (aa 2097-2242) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ADGRC2; adhesion G protein-coupled receptor C2; cadherin EGF LAG seven-pas G-type receptor 2; cadherin EGF LAG seven-pass G-type receptor 2; Cadherin family member 10; cadherin, EGF LAG seven-pass G-type receptor 2; cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila); CDHF10; Celsr2; EGFL2; EGF-like protein 2; EGF-like-domain, multiple 2; epidermal growth factor-like 2; epidermal growth factor-like protein 2; flamingo; Flamingo homolog; flamingo homolog 3; Flamingo1; flamingo-like protein celsr2; FLJ34118; FLJ42737; FLJ45143; FLJ45845; KIAA0279; MEGF3; mfmi1; mKIAA0279; Multiple EGF-like domains protein 3; multiple epidermal growth factor-like domains 3; multiple epidermal growth factor-like domains protein 3; seven-pass transmembrane cadherin
Nombre común CELSR2
Símbolo de gen CELSR2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado