missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CDK13 (aa 1155-1263) Control Fragment Recombinant Protein

Código de producto. 30194776
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30194776 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194776

Marca: Invitrogen™ RP95227

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63692 (PA5-63692. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK13/cyclin K serine/threonine kinase is dimeric protein complex. CDK13 is a member of the cyclin-dependent serine/threonine protein kinase family. Members of this family are well known for their essential roles as master switches in cell cycle control. The exact function of this protein has not yet been determined, but it may play a role in mRNA processing and may be involved in regulation of hematopoiesis. Cyclin K is a member of the transcription cyclin family. These cyclins may regulate transcription through their association with and activation of cyclin-dependent kinases (CDK) that phosphorylate the C-terminal domain of the large subunit of RNA polymerase II.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14004
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 8621
Nombre Human CDK13 (aa 1155-1263) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2310015O17Rik; CDC2L; Cdc2l5; CDC2-related protein kinase 5; CDK13; cell division cycle 2-like 5 (cholinesterase-related cell division controller); cell division cycle 2-like protein kinase 5; Cell division protein kinase 13; CHED; Cholinesterase-related cell division controller; cyclin dependent kinase 13; cyclin-dependent kinase 13; hCDK13; Kiaa1791
Nombre común CDK13
Símbolo de gen Cdk13
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.