missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CDCA2 (aa 761-854) Control Fragment Recombinant Protein

Código de producto. 30206485
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30206485 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30206485

Marca: Invitrogen™ RP93942

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56322 (PA5-56322. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell division cycle associated 2 (CDCA2, Repo-Man) is a cell-cycle protein that recruits protein phosphatase 1 (PP1) to mitotic chromatin at anaphase onset, which is essential for cell proliferation. Carboxy-terminal phosphorylation of CDCA2 at Ser893 by Aurora B inhibits the protein and leads to diffuse localization during prometaphase and metaphase. Dephosphorylation of CDCA2 by PP2A is necessary for CDCA2/PP1 complex reformation. The CDCA2/PP1 complex is required for chromatin binding and dephosphorylation of histone H3 at Thr3, Ser10, and Ser28. The CDCA2/PP1 complex is also involved in nuclear envelope reformation during mitotic exit for proper progression through the M/G1 transition. The interaction of CDCA2 with importin beta and Nup153, which is required for nuclear envelope formation, is negatively regulated by CDK phosphorylation of the amino-terminal domain of CDCA2. CDCA2 may play a role in DNA repair as the release of CDCA2 from chromatin at sites of DNA damage promotes the activation of DNA damage response. These results imply that the CDCA2/PP1 complex may play a part in cancer progression. Research studies indicate that CDCA2 may serve as a prognostic marker, as increased CDCA2 expression is seen in a number of cancers, including melanoma, neuroblastoma tumors, squamous cell carcinoma, and synovial sarcomas.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q69YH5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 157313
Nombre Human CDCA2 (aa 761-854) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2610311M19Rik; AI586158; CDCA2; cell division cycle associated 2; cell division cycle-associated protein 2; FLJ25804; MGC129906; MGC129907; PPP1R81; protein phosphatase 1, regulatory subunit 81; recruits PP1 onto mitotic chromatin at anaphase protein; Repo-Man
Nombre común CDCA2
Símbolo de gen CDCA2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.