missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD300e (aa 33-168) Control Fragment Recombinant Protein

Código de producto. 30201521
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201521

Marca: Invitrogen™ RP90569

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53324 (PA5-53324. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD300e is a member of the glycoprotein family of cell surface proteins expressed on myeloid cells. CD300e interacts with the TYRO protein tyrosine kinase-binding protein and is thought to be involved as an activating receptor. CD300e is expressed on mature myeloid dendritic cells and monocytes, and is down regulated on immature dendritic cells. Further, CD300e interacts with DAP-12, which mediates activating signals. The alloreactive response of naïve T cells has been reported to become enhanced by the activation of CD300e. Diseases associated with CD300e dysfunction include tungiasis and lice infestation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q496F6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 342510
Nombre Human CD300e (aa 33-168) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen BC034097; CD300 antigen like family member E; CD300 antigen-like family member E; CD300e; CD300e antigen; CD300e molecule; Cd300le; CLM2; CLM-2; CMRF35A5; CMRF35-A5; CMRF35-like molecule 2; CMRF-35-like molecule-1; Immune receptor expressed on myeloid cells 2; IREM2; IREM-2; PIgR2; PIgR-2; poly-Ig receptor 2; polymeric immunoglobulin receptor 2; TREM5
Nombre común CD300e
Símbolo de gen CD300E
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVNPGRNLSTGEVLTQNSGFR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado