missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD177 Control Fragment Recombinant Protein

Código de producto. 30196011
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196011

Marca: Invitrogen™ RP109641

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD177 (NB1/HNA-2a and PRV-1 form) is a GPI-anchored glycoprotein present mainly on neutrophils. Its plasma membrane expression is increased during pregnancy and and inflammation or after G-CSF application. Ligand of CD177 has been identified as CD31 (PECAM-1). CD177 participates in neutrophil transmigration and seems to be also a pro-proliferative molecule. The antibodies against CD177 can be involved in neonatal alloimmune neutropenia (NAN).
TRUSTED_SUSTAINABILITY

Spécification

Número de acceso Q8N6Q3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 57126
Nombre Human CD177 Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1190003K14Rik; CD177; CD177 antigen; CD177 molecule; cell surface receptor; HNA2A; HNA-2 A; Human neutrophil alloantigen 2 A; NB1; NB1 glycoprotein; NB1 GP; Pdp3; Polycythemia rubra vera protein 1; PRV1; PRV-1; RGD1562941; UNQ595/PRO1181
Nombre común CD177
Símbolo de gen CD177
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis