Learn More
Invitrogen™ Human c-MAF (aa 1-112) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101907
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110954 (PA5-110954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
c-maf is the cellular counterpart of oncogenic v-maf that belongs to the family of basic region leucine zipper domain transcription factors. The leucine-zipper domain is involved in the interaction with LRPICD. There are two forms of human c-maf mRNA, c-maf-long and c-maf-short. It is identified in the genome of the acute transforming avian retrovirus AS42. c-maf targets are IL-4 in Th2 cells, the crystalline genes in lens fiber cells, insulin gene in islet, p53 and L7 where it exerts its transcriptional role through binding to a Maf recognition element (MARE). It regulates Th2 differentiation and lineage-specific hematopoiesis. c-maf is a transcription factor for IL-10 gene expression in LPS-activated macrophages. Chromosomal aberration involving maf is found in some forms of multiple myeloma. It is expressed in myeloma cell lines and resting monocytes/macrophages.
Especificaciones
O75444 | |
Blocking Assay, Control | |
4094 | |
100 μL | |
2810401A20Rik; A230108G15Rik; Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene; avian musculoaponeurotic fibrosarcoma (v-maf) AS42 oncogene homolog; AW047063; AYGRP; basic domain leucine zipper transcription factor; CCA4; cMaf; C-Maf; c-Maf long form; c-maf proto-oncogene; CTRCT21; fl13d12; hMafA; LOW QUALITY PROTEIN: transcription factor Maf; LOW QUALITY PROTEIN: transcription factor MafA; maf; MAF bZIP transcription factor; MAF bZIP transcription factor A; maf protein; Maf2; MAFA; Mafa homolog; MGC71685; pancreatic beta-cell-specific transcriptional activator; Proto-oncogene c-Maf; RGD1562627; RIPE3b1; RIPE3b1 factor; T lymphocyte c-maf long form; transcription factor Maf; Transcription factor Maf-2; transcription factor MafA; transcription factor RIPE3b1; v-maf avian musculoaponeurotic fibrosarcoma oncogene A; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog A; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog a (paralog a); v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A; v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian); v-maf musculoaponeurotic fibrosarcoma oncogene homolog; V-maf musculoaponeurotic fibrosarcoma oncogene homolog A; wu:fl13d12; Z-cmaf | |
MAF | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human c-MAF (aa 1-112) Control Fragment | |
RUO | |
c-MAF | |
Unconjugated | |
Recombinant | |
MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPED | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.