missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BRK (aa 387-451) Control Fragment Recombinant Protein

Código de producto. 30201684
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201684

Marca: Invitrogen™ RP95234

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83306 (PA5-83306. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Breast tumor kinase (Brk) is a non-receptor protein tyrosine kinase expressed in over 60% of breast carcinoma tissue samples and breast tumor cell lines. Brk is 80% identity to Sik (Src-related intestinal kinase) and exhibits the features of a novel non-receptor tyrosine kinase, including amino terminal SH3 and SH2 domains. Low levels of Brk transcripts have been identified in some human breast tumor cell lines but not in normal breast tissue.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q13882
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 5753
Nombre Human BRK (aa 387-451) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ALT-PTK6; breast tumor kinase; BRK; deltam5; FLJ42088; protein tyrosine kinase 6; protein-tyrosine kinase 6; protein-tyrosine kinase BRK; Ptk6; PTK6 protein tyrosine kinase 6; Sik; SRC-related intestinal kinase; tks; Tksk; tyrosine kinase identified from skin; tyrosine-protein kinase BRK
Nombre común BRK
Símbolo de gen PTK6
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado