missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BNC1 (aa 779-866) Control Fragment Recombinant Protein

Código de producto. 30198939
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30198939 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198939

Marca: Invitrogen™ RP107218

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66563 (PA5-66563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Bnc 1 is a 994 amino acid transcription factor specific for squamous epithelium and for the constituent keratinocytes at a stage either prior to or at the very beginning of terminal differentiation. It is a zinc finger protein with three separated pairs of zinc fingers and a nuclear localization signal. Bnc 1 is a soluble protein that can shuttle between the nucleus and the cytoplasm, and its location depends on the proliferative potential of the cell. It is expressed relatively uniformly in the nucleoplasm, and phosphorylation on Ser-537 and Ser-541 leads to its cytoplasmic localization. It is present in the basal cell layer of the epidermis, in hair follicles and also in abundance in the germ cells of testis and ovary, and to a lower extent in thymus, spleen, mammary glands, placenta, brain and heart. Reports suggest that it plays a regulatory role in keratinocyte proliferation and also in rRNA transcription. It is also known to play a role in the differentiation of spermatozoa and oocytes.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q01954
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 646
Nombre Human BNC1 (aa 779-866) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI047752; AW546376; basonuclin 1; BNC; bnc 1; Bnc1; BSN1; HsT19447; zinc finger protein basonuclin-1
Nombre común BNC1
Símbolo de gen BNC1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.