missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30200389

Invitrogen™ Human Bcl-X (aa 1-70) Control Fragment Recombinant Protein

Código de producto. 30200389
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30200389 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200389

Marca: Invitrogen™ RP102677

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded the BCL-X gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q07817
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 598
Nombre Human Bcl-X (aa 1-70) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen anti-apoptosis regulatory protein; anti-apoptotic Bcl-2 gene family member; anti-apoptotic Bcl-xL; anti-apoptotic regulator Bcl-xL; apoptosis regulator Bcl-X; B cell lymphoma 2 like; B cell lymphoma like X; B-cell leukemia/lymphoma x; Bcl 2 like 1; bcl x; Bcl xL; BCL XL/S; Bcl(X)L; bcl-2 L1; BCL2 like 1; BCL2L; Bcl2l1; bcl2-L-1; BCL2-like 1; Bcl-2-like protein 1; BCL2-like protein 1; BCLX; bcl-x; Bcl-x long protein; BclxL; Bcl-xL; BCL-XL/S; BclXS; bcl-xS; BLC2L; DKFZp781P2092; PPP1R52; protein phosphatase 1, regulatory subunit 52; RP5-857M17.3; unnamed protein product
Nombre común BCL-X
Símbolo de gen BCL2L1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.