missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30213164

Invitrogen™ Human ATP2C2 (aa 25-109) Control Fragment Recombinant Protein

Código de producto. 30213164
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30213164

Marca: Invitrogen™ RP95779

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62577 (PA5-62577. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP2C2, also known as secretory pathway Ca2+/Mn2+-ATPase (SPCA) 2, belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium from the cytosol to the Golgi lumen. Defects in the related gene ATP2C1 cause Hailey-Hailey disease, for which ATP2C2 does not compensate, suggesting that ATP2C2 plays other physiological roles. Unlike ATP2C1, ATP2C2 has a much more restricted expression pattern and displays a higher maximal turnover rate for overall Ca2+-ATPase reaction and a lower apparent affinity for cytosolic Ca2+ activation of phosphorylation. Overexpression of ATP2C2 in mammary tumors result a Ca2+ influx via the store-operated Ca2+ channel ORAI1 and independent of the STIM1 and STIM2 sensors.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O75185
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9914
Nombre Human ATP2C2 (aa 25-109) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1810010G06Rik; Atp2c2; ATPase 2C2; ATPase secretory pathway Ca2+ transporting 2; ATPase, Ca++ transporting, type 2 C, member 2; calcium-transporting ATPase type 2 C member 2; Kiaa0703; mKIAA0703; Secretory pathway Ca(2+)-ATPase 2; secretory pathway Ca2+-ATPase; secretory pathway calcium ATPase 2; Spca2
Nombre común ATP2C2
Símbolo de gen ATP2C2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado