missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATP Synthase beta (aa 50-191) Control Fragment Recombinant Protein

Código de producto. 30212007
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212007

Marca: Invitrogen™ RP100510

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81950 (PA5-81950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P06576
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 506
Nombre Human ATP Synthase beta (aa 50-191) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ATP synthase F1 subunit beta; ATP synthase subunit beta, mitochondrial; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; Atp5b; ATP5F1B; ATPMB; ATPSB; beta-subunit; epididymis secretory protein Li 271; f1-ATPase beta; F1-ATPase beta-subunit; F-1-ATPase beta-subunit precursor; fj13e04; fj55c09; HEL-S-271; hm:zehn0534; hypothetical protein LOC554135; im:6793121; MGC5231; mitochondrial ATP synthase beta subunit; mitochondrial ATP synthase subunit beta subunit; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; mitochondrial ATP synthetase, beta subunit; wu:fj13e04; wu:fj38d01; wu:fj55c09; zgc:111961
Nombre común ATP Synthase beta
Símbolo de gen ATP5F1B
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado