missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212934

Invitrogen™ Human ARHGAP17 (aa 800-870) Control Fragment Recombinant Protein

Código de producto. 30212934
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30212934 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212934

Proveedor: Invitrogen™ RP110214

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145117 (PA5-145117. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q68EM7
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 55114
Nombre Human ARHGAP17 (aa 800-870) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5730403H17Rik; Arhgap17; MST066; MST110; MSTP038; MSTP066; MSTP110; Nadrin; Nadrin2; neuron-associated developmentally regulated protein; neuron-associated developmentally-regulated protein; neuron-specific GTPase activating protein; neuron-specific GTPase-activating protein; PP367; PP4534; Rho GTPase activating protein 17; rho GTPase-activating protein 17; RhoGAP interacting with CIP4 homologs 1; RhoGAP interacting with CIP4 homologs protein 1; Rho-type GTPase-activating protein 17; Rich1; RICH-1; RICH1B; WBP15; WW domain-binding protein 15
Nombre común ARHGAP17
Símbolo de gen Arhgap17
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.