missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212277

Invitrogen™ Human APC15 (aa 6-69) Control Fragment Recombinant Protein

Código de producto. 30212277
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212277

Marca: Invitrogen™ RP97313

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57736 (PA5-57736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANAPC15 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. In the complex, it plays a role in the release of the mitotic checkpoint complex (MCC) from the APC/C: not required for APC/C activity itself, but promotes the turnover of CDC20 and MCC on the APC/C, thereby participating to the responsiveness of the spindle assembly checkpoint. It is also required for degradation of CDC20.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P60006
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 25906
Nombre Human APC15 (aa 6-69) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 3200002M19Rik; 6330414C15Rik; Anapc15; anaphase promoting complex subunit 15; anaphase prompoting complex C subunit 15; anaphase-promoting complex subunit 15; APC15; C11orf51; C15H11orf51; C21H11orf51; HSPC020; hypothetical protein LOC505356; protein HSPC020 homolog; RGD1311634; uncharacterized protein C11orf51 homolog; Unknown (protein for MGC:153425); zgc:153425
Nombre común APC15
Símbolo de gen Anapc15
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado