missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30204913

Invitrogen™ Human AP4M1 (aa 196-266) Control Fragment Recombinant Protein

Código de producto. 30204913
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30204913 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30204913

Marca: Invitrogen™ RP107517

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84736 (PA5-84736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-Golgi network to the endosomal-lysosomal system.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O00189
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9179
Nombre Human AP4M1 (aa 196-266) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 4930443L05Rik; adapter-related protein complex 4 mu-1 subunit; adapter-related protein complex 4 subunit mu-1; adaptor related protein complex 4 mu 1 subunit; adaptor related protein complex 4, mu 1 subunit; adaptor-related protein complex 4 subunit mu-1; adaptor-related protein complex 4, mu 1 subunit; adaptor-related protein complex AP-4 mu4 subunit; adaptor-related protein complex AP-4, mu 1; AP-4 adapter complex mu subunit; AP-4 adaptor complex mu subunit; AP-4 complex subunit mu-1; Ap4m1; ap4m1 {ECO:0000312; Ap4m4; CPSQ3; Mu subunit of AP-4; mu4; MU-4; mu4-adaptin; Mu-adaptin-related protein 2; mu-adaptin-related protein-2; MUARP2; mu-ARP2; RGD:1310233}; SPG50
Nombre común AP4M1
Símbolo de gen AP4M1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.