missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30198660

Invitrogen™ Human ALKBH2 (aa 173-255) Control Fragment Recombinant Protein

Código de producto. 30198660
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30198660 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198660

missing translation for 'mfr': Invitrogen™ RP106087

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65405 (PA5-65405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The E. coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA; ALKBH2 and ALKBH3 are mammalian homologs of AlkB that catalyze the removal of 1-methyladenine and 3-methylcytosine, modifications that left unchecked could lead to cancerous cells. Mutations in both ALKBH2 and ALKBH3 have been observed in pediatric brain tumors indicating that these proteins are important in the prevention of cancer formation. Like the histone demethylase JMJD1A, ALKBH2 is a non-heme iron enzyme that is inhibited by Nickel ions, suggesting that inhibition of ALKBH2 by Nickel ions may play a role in the development of cancer. Conversely, ALKBH2 mRNA and protein levels are increased glioma cells following Photofrin-mediated photodynamic therapy, an adjuvant therapy in cancer treatment, suggesting that down-regulating ALKBH2 expression in cancer cells may enhance the anti-cancer effectiveness of this treatment.
TRUSTED_SUSTAINABILITY

Spécification

Número de acceso Q6NS38
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 121642
Nombre Human ALKBH2 (aa 173-255) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2 OG-Fe(II) oxy DC1; 9530023G02; Abh2; AlkB homolog 2; alkB homolog 2, alpha-ketoglutarate dependent dioxygenase; alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase; alkB, alkylation repair homolog 2; alkB, alkylation repair homolog 2 (E. coli); ALKBH2; Alkylated DNA repair protein alkB homolog 2; alpha-ketoglutarate-dependent dioxygenase alkB homolog 2; AU016977; DNA oxidative demethylase ALKBH2; mABH2; oxy DC1; RGD1306377
Nombre común ALKBH2
Símbolo de gen ALKBH2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.