missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30208112

Invitrogen™ Human AIM (aa 207-277) Control Fragment Recombinant Protein

Código de producto. 30208112
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30208112 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30208112 Proveedor Invitrogen™ N.º de proveedor RP103606

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84699 (PA5-84699. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD5L, also known as CD5 antigen-like, is a protein that is expressed on the surface of various immune cells, including T cells, B cells, and natural killer cells. It is involved in the regulation of immune responses and is being studied as a potential therapeutic target in various diseases, including autoimmune disorders, cancer, and infectious diseases. CD5L is known to modulate T cell activation and cytokine production, and has been shown to have anti-inflammatory effects.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O43866
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 922
Nombre Human AIM (aa 207-277) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1/6; AAC-11; AI047839; AIM; AIM/Spalpha; API6; apoptosis inhibitor 6; apoptosis inhibitor expressed by macrophages; apoptosis inhibitor of macrophage; APOPTOSIS INHIBITOR OF MACROPHAGES; Apoptosis inhibitory 6; CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; CD5 antigen-like (scavenger receptor cysteine rich family); CD5 molecule like; Cd5 molecule-like; CD5L; CT2; CT-2; hAIM; Highly similar to ANTIGEN WC1.1 [Bos taurus]; igM-associated peptide; mAIM; Pdp; Pdp 1/6; PRO229; SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY; Spalpha; Sp-alpha; UNQ203/PRO229
Nombre común CD5L
Símbolo de gen Cd5l
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.