missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Afadin (aa 1463-1565) Control Fragment Recombinant Protein Código de producto.: 30196146
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30196146

Invitrogen™ Human Afadin (aa 1463-1565) Control Fragment Recombinant Protein

Código de producto. 30196146
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196146

Marca: Invitrogen™ RP94823

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83131 (PA5-83131. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AFDN belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P55196
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4301
Nombre Human Afadin (aa 1463-1565) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5033403D15Rik; Af6; Af-6; Afadin; Afadin adherens junction formation factor; afadin, adherens junction formation factor; afadin; afadin, adherens junction formation factor; AFDN; ALL1-fused gene from chromosome 6 protein; FLJ34371; Gm314; I-afadin; MLL-AF6; MLLT4; myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4; myeloid/lymphoid or mixed-lineage leukemia 4; myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4; protein Af-6; RP3-431P23.3; RP3-470B24.4; S-afadin
Nombre común Afadin
Símbolo de gen Afdn
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human Afadin (aa 1463-1565) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado