missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212748

Invitrogen™ Human ADSL (aa 337-480) Control Fragment Recombinant Protein

Código de producto. 30212748
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30212748 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212748

Marca: Invitrogen™ RP91375

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51401 (PA5-51401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADSL (adenylosuccinate lyase), also known as AMPS, ASL or ASASE, is a 484 amino acid protein that is involved in both purine biosynthesis and in the formation of adenosine monophosphate (AMP) from inosine monophosphate. Expressed ubiquitously, ADSL catalyzes two key reactions in AMP biosynthesis, namely the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and the subsequent removal of fumarate from adenylosuccinate to yield AMP. Defects in the gene encoding ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency), an autosomal recessive disorder characterized by epilepsy, growth retardation and muscular wasting. Multiple isoforms of ADSL exist due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P30566
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 158
Nombre Human ADSL (aa 337-480) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2510006M18Rik; Adenylosuccinase; adenylosuccinate lyase; adenylosuccinate lyase 1; Adl; Adsl; AMPS; argininosuccinase; argininosuccinate lyase; Arginosuccinase; ASAL; ASase; ASL; null; test; unnamed protein product
Nombre común ADSL
Símbolo de gen Adsl
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.