missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30207068

Invitrogen™ Human ADAMTSL1 (aa 1375-1500) Control Fragment Recombinant Protein

Código de producto. 30207068
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30207068 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30207068

Marca: Invitrogen™ RP89737

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63442 (PA5-63442. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Punctin (ADAMTSL-1) is a secreted molecule, expressed in adult skeletal muscle, resembling members of the ADAMTS family of proteases, containing four thrombospondin type I repeats. Human punctin cleaves aggrecan and is thereby classified as an aggrecanase. Like the ADAMTS proteases, each domain in punctin has an even number of cysteine residues suggesting that each domain may have internal disulfide bonds and that punctin consists of a series of independently folded and disulfide-bonded domains.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8N6G6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 92949
Nombre Human ADAMTSL1 (aa 1375-1500) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5930437A14Rik; 6720426B09Rik; a disintegrin and metalloproteinase; ADAM; ADAMs; ADAMTS like 1; ADAM-TS related protein 1; Adamtsl1; ADAMTSL-1; ADAMTS-like 1; ADAMTS-like protein 1; ADAMTSR1; C9orf94; DKFZp686L03130; FLJ35283; FLJ41032; FLJ46891; metalloendopeptidases; MGC118803; MGC118805; MGC40193; PUNCTIN; Punctin-1; RP11-220B22.2; UNQ528/PRO1071
Nombre común ADAMTSL1
Símbolo de gen ADAMTSL1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QVPTQLEDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.