missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human A4GALT (aa 45-145) Control Fragment Recombinant Protein

Código de producto. 30196921
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30196921 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196921

Marca: Invitrogen™ RP108091

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67429 (PA5-67429. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9NPC4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 53947
Nombre Human A4GALT (aa 45-145) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen A14GALT; A4GALT; A4galt {ECO:0000312; A4GALT1; alpha 1,4-galactosyltransferase; alpha 14-galactosyltransferase; alpha-1,4-galactosyltransferase; Alpha-1,4-N-acetylglucosaminyltransferase; alpha4Gal-T1; cd77; CD77 synthase; Gb3; Gb3 synthase; Gb3/CD77 synthase; Gb3S; Globotriaosylceramide synthase; lac; lactosylceramide 4-alpha-galactosyltransferase; P blood group (P one antigen); P(k); P(k) antigen synthase; P1; P1/Pk. synthase; P1PK; Pk.; RGD:621583}; truncated alpha 1,4-galactosyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Nombre común A4GALT
Símbolo de gen A4galt
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.