missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
Hsp70 interacting protein HIP Polyclonal antibody specifically detects Hsp70 interacting protein HIP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | Hsp70 interacting protein HIP |
| Aplicaciones | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Formulación | PBS (pH 7.2), 40% Glycerol |
| Alias de gen | AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to amino acids: KVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEP |
| Método de purificación | Immunogen affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?