missing translation for 'onlineSavingsMsg'
Learn More

HPRT Antibody, Novus Biologicals™

Código de producto. 18270804 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
18270804 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18270804

Marca: Novus Biologicals NBP152903

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

HPRT Polyclonal specifically detects HPRT in Human, Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno HPRT
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen P00492
Alias de gen EC 2.4.2.8, HGPRTHPRTHGPRTase, hypoxanthine phosphoribosyltransferase 1, hypoxanthine-guanine phosphoribosyltransferase
Símbolos de los genes HPRT1
Especie del huésped Rabbit
Inmunógeno Synthetic peptide directed towards the middle region of human HPRT1 (NP_000185). Peptide sequence STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK The peptide sequence for this immunogen was taken from within the described region.
Peso molecular del antígeno 24 kDa
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Lipid and Metabolism
Primario o secundario Primary
ID de gen (Entrez) 3251
Especificidad de la prueba Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.