missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Hormone-sensitive Lipase/HSL Recombinant Protein Antigen

Código de producto. 18233924 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μl
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
18233924 100 μl 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18233924

Marca: Novus Biologicals™ NBP258889PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Hormone-sensitive Lipase/HSL. Source: E.coli Amino Acid Sequence: HLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALTQLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLVSFGEHYKRNE The Hormone-sensitive Lipase/HSL Recombinant Protein Antigen is derived from E. coli. The Hormone-sensitive Lipase/HSL Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 3991
Método de purificación >80% by SDS-PAGE and Coomassie blue staining
Nombre común Hormone-sensitive Lipase/HSL Recombinant Protein Antigen
Contenido y almacenamiento Store at −20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Alias de gen hormone-sensitive lipase, hormone-sensitive lipase testicular isoform, HSLEC 3.1.1.79, LHS, lipase, hormone-sensitive
Símbolo de gen LIPE
Tipo de etiqueta Unlabeled
Tipo de producto Recombinant Protein Antigen
Cantidad 100 μl
Estado normativo RUO
Fuente E.coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51054. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mostrar más Mostrar menos

Para uso exclusivo en investigación.

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.