missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. HMGCS1 Antibody, Novus Biologicals™

HMGCS1 Antibody, Novus Biologicals™

Código de producto. 18407281 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25ul
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18407281 25ul 25 microlitros
18011189 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18407281

Marca: Novus Biologicals NBP21409425ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

HMGCS1 Polyclonal specifically detects HMGCS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno HMGCS1
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase, 3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble), EC 2.3.3.10, HMG-CoA synthase, HMGCS, hydroxymethylglutaryl-CoA synthase, cytoplasmic, MGC90332
Símbolos de los genes HMGCS1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the amino acids: TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWY
Método de purificación Affinity Purified
Cantidad 25ul
Estado normativo RUO
Disciplina de investigación Cardiovascular Biology
Primario o secundario Primary
ID de gen (Entrez) 3157
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.