missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA DMA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55086
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
HLA DMA Polyclonal specifically detects HLA DMA in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| HLA DMA | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| class II histocompatibility antigen, M alpha chain, D6S222E, DMA, HLA class II histocompatibility antigen, DM alpha chain, major histocompatibility complex, class II, DM alpha, MHC class II antigen DMA, Really interesting new gene 6 protein, RING6HLADM | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| HLA-DMA | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENV | |
| 100 μL | |
| Asthma, Diabetes Research, Immunology | |
| 3108 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido