missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HLA A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
202.00€ - 573.00€
Especificaciones
| Antígeno | HLA A |
|---|---|
| Dilución | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:20 |
| Aplicaciones | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
30229760
|
Novus Biologicals
NBP3-37966-20ul |
20 μL |
202.00€
20 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
30228118
|
Novus Biologicals
NBP3-37966-100ul |
100 μL |
573.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
HLA A Polyclonal antibody specifically detects HLA A in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Especificaciones
| HLA A | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, Cell Biology, Immunology | |
| PBS (pH 7.3), 50% glycerol | |
| 3105 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:20 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| A-10 alpha chain, FLJ26655, HLA class I histocompatibility antigen, A-1 alpha chain, HLA class I histocompatibility antigen, A-28 alpha chain, HLA class I histocompatibility antigen, A-9 alpha chain, HLAA, major histocompatibility complex, class I, A, MHC class I antigen A*1, MHC class I antigen A*11, MHC class I antigen A*80 | |
| A synthetic peptide corresponding to a sequence within amino acids 35-285 of human HLA A (NP_002107.3).,, Sequence:, GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto