missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIV-1 Gag p24 Antibody (7F4) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
Marca: Novus Biologicals NBP2-41339
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.
Especificaciones
HIV-1 Gag p24 | |
Monoclonal | |
1 mg/mL | |
Western Blot 0.2-0.5 μg/mL, ELISA 0.2- 0.5 μg/mL | |
Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24 | |
Mouse | |
24, 41, 55 kDa | |
0.1 mg | |
Secondary | |
By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Western Blot, ELISA | |
7F4 | |
Unconjugated | |
PBS with 0.02% Sodium Azide | |
gag | |
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
Protein A purified | |
RUO | |
155030 | |
Virus | |
Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
HIV-1 Gag p24 Antibody (7F4) - BSA Free, Novus Biologicals™ > 0.1mg; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido