Learn More
Abnova™ HDAC8 Recombinant Protein
Descripción
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA.
- Human HDAC8 full-length ORF ( AAH50433, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal
- histone deacetylase 8
- Theoretical molecular weight: 66.99kDa
- Preparation: in vitrowheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSPAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDG VEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Especificaciones
Especificaciones
| Número de acceso | AAH50433 |
| Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID de gen (Entrez) | 55869 |
| Peso molecular | 66.99 |
| Nombre | HDAC8 (Human) Recombinant Protein (P01) |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Método de purificación | Glutathione Sepharose 4 Fast Flow |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Mostrar más |
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.