missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Granulysin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 556.50€
Especificaciones
| Antígeno | Granulysin |
|---|---|
| Dilución | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18620776
|
Novus Biologicals
NBP2-38839-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18188558
|
Novus Biologicals
NBP2-38839 |
0.1 mL |
 589.00€ 556.50€ / 0.10 ml Ahorro 32.50€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Granulysin Polyclonal specifically detects Granulysin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| Granulysin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| P22749 | |
| 10578 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| D2S69Elymphocyte-activation gene 2, granulysin, LAG2, LAG-2, Lymphokine LAG-2, NKG5519, Protein NKG5, TLA519T-cell activation protein 519, T-lymphocyte activation gene 519 | |
| GNLY | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto