missing translation for 'onlineSavingsMsg'
Learn More

GPR177/WLS Antibody, Novus Biologicals™

Código de producto. 18265273 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
18265273 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18265273

Marca: Novus Biologicals NBP159013

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

GPR177/WLS Polyclonal specifically detects GPR177/WLS in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno GPR177/WLS
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen Q5T9L3
Alias de gen C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-kappa-B-activating protein 373, putative NFkB activating protein 373, wntless homolog (Drosophila)
Símbolos de los genes WLS
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to GPR177(G protein-coupled receptor 177) The peptide sequence was selected from the middle region of GPR177. Peptide sequence DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE.
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 79971
Especificidad de la prueba Expected identity based on immunogen sequence: Chicken: 100%.
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.