missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glycophorin A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00€ - 529.00€
Especificaciones
| Antígeno | Glycophorin A |
|---|---|
| Dilución | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18490401
|
Novus Biologicals
NBP1-85775 |
0.1 mL |
529.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18433791
|
Novus Biologicals
NBP1-85775-25ul |
25 μL |
386.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Glycophorin A Polyclonal antibody specifically detects Glycophorin A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Especificaciones
| Glycophorin A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2993 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD235a antigen, glycophorin A (includes MN blood group), glycophorin A (MNS blood group), glycophorin Erik, glycophorin MiI, glycophorin MiIII, glycophorin MiV, glycophorin MiX, glycophorin SAT, glycophorin Sta type C, glycophorin-A, GPA, GPErik, GpMiIII, GPSAT, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta(C), Mi.V glycoprotein (24 AA), MN sialoglycoprotein, MNS, PAS-2, recombinant glycophorin A-B Miltenberger-DR | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto