missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glycophorin A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-85775
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Glycophorin A Polyclonal antibody specifically detects Glycophorin A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| Glycophorin A | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CD235a antigen, glycophorin A (includes MN blood group), glycophorin A (MNS blood group), glycophorin Erik, glycophorin MiI, glycophorin MiIII, glycophorin MiV, glycophorin MiX, glycophorin SAT, glycophorin Sta type C, glycophorin-A, GPA, GPErik, GpMiIII, GPSAT, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta(C), Mi.V glycoprotein (24 AA), MN sialoglycoprotein, MNS, PAS-2, recombinant glycophorin A-B Miltenberger-DR | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP | |
| 0.1 mL | |
| Cancer, Signal Transduction | |
| 2993 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido