missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Glutathione S-Transferase pi 1/GSTP1 Antibody, Novus Biologicals™

Glutathione S-Transferase pi 1/GSTP1 Antibody, Novus Biologicals™

Código de producto. 18458080 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18458080 0.1 mL 0.10 ml
18474681 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18458080 Proveedor Novus Biologicals N.º de proveedor NBP184748

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

Glutathione S-Transferase pi 1/GSTP1 Polyclonal antibody specifically detects Glutathione S-Transferase pi 1/GSTP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Glutathione S-Transferase pi 1/GSTP1
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500-1:1000
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen deafness, X-linked 7, EC 2.5.1.18, FAEES3, fatty acid ethyl ester synthase III, glutathione S-transferase P, glutathione S-transferase pi 1, GST class-pi, GST3DFN7, GSTP, GSTP1-1, PI
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Asthma, Cancer, Immunology
Primario o secundario Primary
ID de gen (Entrez) 2950
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.