missing translation for 'onlineSavingsMsg'
Learn More

Glucose Transporter GLUT6 Antibody, PerCP, Novus Biologicals™

Código de producto. 18516413 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
Tamaño de la unidad:
0.10 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18516413 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18516413 Proveedor Novus Biologicals N.º de proveedor NBP159891PCP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Glucose Transporter GLUT6 Polyclonal antibody specifically detects Glucose Transporter GLUT6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Glucose Transporter GLUT6
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado PerCP
Dilución Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulación PBS
Alias de gen Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region.
Método de purificación Protein A purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 11182
Especies diana Human
Contenido y almacenamiento Store at 4C in the dark.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.