missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
Glucose Transporter GLUT6 Polyclonal antibody specifically detects Glucose Transporter GLUT6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | Glucose Transporter GLUT6 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | PerCP |
| Dilución | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Formulación | PBS |
| Alias de gen | Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6 |
| Especie del huésped | Rabbit |
| Inmunógeno | Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region. |
| Método de purificación | Protein A purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?