missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glucose Transporter GLUT6 Antibody, PerCP, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-59891PCP
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Glucose Transporter GLUT6 Polyclonal antibody specifically detects Glucose Transporter GLUT6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
| Glucose Transporter GLUT6 | |
| Polyclonal | |
| Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6 | |
| Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region. | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| PerCP | |
| PBS | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 11182 | |
| Store at 4C in the dark. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Spot an opportunity for improvement?Share a Content Correction