missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Galectin-3BP/MAC-2BP/LGALS3BP Antibody, Novus Biologicals™

Galectin-3BP/MAC-2BP/LGALS3BP Antibody, Novus Biologicals™

Código de producto. p-200038256 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18462681 25 μL 25 microlitros
18795733 - 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18462681

Marca: Novus Biologicals NBP18934625ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody has been used in 3 publications

Galectin-3BP/MAC-2BP/LGALS3BP Polyclonal specifically detects Galectin-3BP/MAC-2BP/LGALS3BP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Galectin-3BP/MAC-2BP/LGALS3BP
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Concentración 0.2mg/mL
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500-1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen 90K, Basement membrane autoantigen p105, BTBD17B, galectin-3-binding protein, L3 antigen, Lectin galactoside-binding soluble 3-binding protein, lectin, galactoside-binding, soluble, 3 binding protein, M2BP, Mac-2 BP, Mac-2-binding protein, MAC2BP, MAC-2-BP, serum protein 90K, Tumor-associated antigen 90K
Símbolos de los genes LGALS3BP
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 3959
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.