missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Galectin-10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-87688
Código de producto. 18216188
-
624.00€
590.10€ / 0.10 ml
Ahorro 33.90€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Galectin-10 Polyclonal specifically detects Galectin-10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| Galectin-10 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Charcot-Leyden crystal proteinLGALS10A, EC 3.1.1.5, eosinophil lysophospholipase, Gal-10, GAL10, galectin 10, galectin-10, LGALS10, LPPL_HUMAN, Lysolecithin acylhydrolase, MGC149659 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CLC | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM | |
| 0.1 mL | |
| Signal Transduction | |
| 1178 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido