missing translation for 'onlineSavingsMsg'
Learn More

GAB1 Antibody, Novus Biologicals™

Código de producto. p-200102623 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
20 μL
100 μL
Tamaño de la unidad:
100 microlitros
20 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30232747 20 μL 20 microlitros
30230558 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30232747 Proveedor Novus Biologicals N.º de proveedor NBP33342820ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Monoclonal Antibody

GAB1 Monoclonal antibody specifically detects GAB1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno GAB1
Aplicaciones ELISA, Western Blot
Clasificación Monoclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
Formulación PBS (pH 7.3), 50% glycerol, 0.05% BSA
Alias de gen GRB2-associated binder 1, GRB2-associated binding protein 1, GRB2-associated-binding protein 1, Growth factor receptor bound protein 2-associated protein 1
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 594-694 of human GAB1 (NP_002030.2).,, Sequence:, PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
Método de purificación Affinity purified
Cantidad 20 μL
Estado normativo RUO
Disciplina de investigación Apoptosis, Phospho Specific, Signal Transduction, Tyrosine Kinases
Primario o secundario Primary
ID de gen (Entrez) 2549
Especies diana Human, Mouse
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.