missing translation for 'onlineSavingsMsg'
Learn More

G protein alpha Antibody, Novus Biologicals™

Código de producto. 18472541 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18472541 25 μL 25 microlitros
18203297 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18472541

Proveedor: Novus Biologicals NBP18975225ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

G protein alpha Polyclonal specifically detects G protein alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno G protein alpha
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen Adenylate cyclase-stimulating G alpha protein, AHO, Alternative gene product encoded by XL-exon, Extra large alphas protein, GNAS complex locus, GNAS1GSA, GNASXL, GPSAC20orf45, GSP, guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1, guanine nucleotide regulatory protein, guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas, MGC33735, NESP, NESP55, neuroendocrine secretory protein, PHP1A, PHP1B, PHP1C, POH, protein ALEX, SCG6, secretogranin VI, XLalphas
Símbolos de los genes GNAS
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 2778
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.