missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fumarylacetoacetate hydrolase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-48736-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Fumarylacetoacetate hydrolase Polyclonal antibody specifically detects Fumarylacetoacetate hydrolase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
| Fumarylacetoacetate hydrolase | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| beta-diketonase, EC 3.7.1.2, FAA, fumarylacetoacetase, Fumarylacetoacetate hydrolase, fumarylacetoacetate hydrolase (fumarylacetoacetase) | |
| This antibody was developed against a recombinant protein corresponding to amino acids: INLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGD | |
| 25 μL | |
| Lipid and Metabolism | |
| 2184 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido