missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. FPRL1/FPR2 Antibody, Novus Biologicals™

FPRL1/FPR2 Antibody, Novus Biologicals™

Código de producto. 18426851 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18426851 0.1 mL 0.10 ml
18491982 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 18426851 Sous-traitant Novus Biologicals N° du sous-traitant NBP190180

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

FPRL1/FPR2 Polyclonal antibody specifically detects FPRL1/FPR2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antígeno FPRL1/FPR2
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen ALXR, FMLP-R-II, FMLPX, formyl peptide receptor 2, Formyl peptide receptor-like 1RFP, FPR2A, FPRH1FMLP-related receptor I, FPRL1LXA4 receptor, HM63FPRH2, Lipoxin A4 receptor, lipoxin A4 receptor (formyl peptide receptor related), LXA4RFMLP-R-I, N-formyl peptide receptor 2
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: DTYCTFNFASWGGTPEERLKVAITMLTARG
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación GPCR, Immunology
Primario o secundario Primary
ID de gen (Entrez) 2358
Especies diana Human, Mouse
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.