missing translation for 'onlineSavingsMsg'
Learn More

FoxJ1/HFH4 Antibody, Novus Biologicals™

Código de producto. p-200042027 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18413712 25 μL 25 microlitros
18017703 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18413712

Marca: Novus Biologicals NBP18792825ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 3 publications

FoxJ1/HFH4 Polyclonal specifically detects FoxJ1/HFH4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno FoxJ1/HFH4
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clasificación Polyclonal
Concentración 0.3mg/mL
Conjugado Unconjugated
Dilución Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID:35288560)., Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Validated for IHC-Frozen from a verified customer review.
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen FKHL13forkhead transcription factor HFH-4, forkhead box J1, forkhead-like 13, Forkhead-related protein FKHL13, Hepatocyte nuclear factor 3 forkhead homolog 4, HFH4fork head homologue 4, HFH-4forkhead box protein J1, MGC35202
Símbolos de los genes FOXJ1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Transcription Factors and Regulators
Primario o secundario Primary
ID de gen (Entrez) 2302
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.